Thursday, 31 October 2019
Hallowe'en 2019
Exploding food? A variety of canned-goods including surströmming fermented fish [poooeee!] heated to bursting point. Don't do this at home - find a forest. Please be safe tonight, don't let your kids do dumb-ass things with fireworks and bonfires.
Wednesday, 30 October 2019
Platelet donation
As you know, blood consists of plasma, red cells, white cells and platelets. Circulating in the plasma are the clotting factors Factor VIII and Factor IX used to treat haemophilia [which prev], they are proteins, macromolecules, made of amino acids. Also present in the blood of some people is anti-D, an antibody against Rhesus factor; it is used to treat haemolytic disease of the newborn HDN [which prev]. Antibodies are also proteins, macromolecules, made of amino acids. I go on about the macromolecule schtick because my PTs really cannot grasp relative size no matter how much I bang on about it.
Traditional blood donors can give whole blood every 90 days. This blood is usually typed for ABO and Rhesus blood groups and then separated into packed red cells, plasma, platelets and proteins.
| Type |
Shelf-life
| Store Temp |
Schedule
|
Notes
|
RBC
|
42 days
|
4°C
|
90 days
|
|
Plasma
|
360 days
|
-20°C
|
30 days
|
|
Platelets
|
5 days
|
18°C
|
30 days
|
rocker
|
CryoPPT
|
360 days
| -20°C |
30/90 days
|
FVIII, FIX
|
There are never enough donors, so "apheresis donation" has been developed to harvest plasma and platelets every 30 days. Donors are given an anti-coagulant (?Warfarin?) and their whole circulatory system is connected to a machine that spins the blood as it comes through, separating the red and white cells, the platelets and the plasma. The cells spin to the bottom of the machine and are returned to sender. The platelets layer themselves halfway down and are directed to one bag, the plasma (54%) is sent to another bag. The clotting factors are later separated from plasma by cycles of freezing and thawing.
Why don’t they want blood from women who have been pregnant or have ever had a blood transfusion? Because they have been exposed to blood from a different person. Sometimes, minute quantities of blood may leak across the placenta from the foetus even early on in pregnancy. Coming up for, and during, delivery there is more active blood-sharing as the placenta loosens up and things down there get squeezed. The mother will develop antibodies to any blood which is different from hers and these antibodies will persist undetectable in the plasma / platelets as they are processed through the apheresis machine. These antibodies may cause problems in the third party in the process – the recipient of the platelets – who will be genetically different yet again from mother and foetus. Like not wanting blood from residents from the UK in the 1980s who may have been exposed to mad cow disease [variant CJD], the Platelet industry is operating under the Precautionary Principle about these potential anti-bodies. Despite crying out for more platelet donors.
They only have Apheresis Clinics in Dublin and Cork and it takes 2 hours. I guess they give you and cup of tea, but better bring a book or a good movie on your phone. Call 01 4322833 (Dublin) or 021 4807429 (Cork) for an appointment.
Sources:
2+ mins on apheresis donation (for plasma / platelets)
4 mins on Blood Component Separation
Tuesday, 29 October 2019
Stayin' alive
The CDC says that the Bee-Gees can help you pace your push on your neighbour's chest when s/he's dying. They also say that, for cardiac arrest away from hospital, only 10% survive but that your CPR can up the rate 2- to 3-fold. Reuter's report a more realistic definition of a result that matters: 10% for survival to discharge from hospital. With 350,000 'wild' cardiac arrests in the USA each year, people-power CPR results in 350,000 * (30%-10%) = 70,000 incapacitated extra people alive each year occupying 7% of the 940,000 hospital beds in the country. The UK currently has 160,000 hospital beds [down from 240,000 in 2000!]. Henry "Do No Harm" Marsh [prev] says in his new book [Admissions reviewed later] that 7,000 =4% of those beds are occupied by deeply comatose bodies in a persistent vegetative state. Some of the diverted there from "sucessful" CPR. Proportions will surely be about the same wherever you live. They agree with the figures in UK, where someone floated an annual Restart-a-Heart Day. That concept has gone international and happens in mid-October all over Ireland so you've missed your chance for training this year.
A portable defibrillator can be useful for jolting the heart back to life. Word on the street is that, when someone ran for The Institute's defib during the drama last Tuesday, there was nothing in the box. Someone had "borrowed" it. I hope its hanging in an impoverished GAA club somewhere. An AED Automatic External Defibrillator costs about €1200 in Ireland and there is clearly a buoyant market for this kit; with at least 20 competitively priced brands. All competing for a memorable name too: Philips HeartStart shown R. This guide will help you through the marketing to understand what matters in your purchase. Actually that guide is far too wordy and dense. This one is Irish and easier to read and better focussed.
Monday, 28 October 2019
Bones bones bones
I guess if I offered them €1 for each identified bone, then they'd work harder to get to 206 . . . without working too hard so that they fudge the answer to make it right. I've also included the official answer (from St Wiki of Pedia) of how the agreed N = 206 is arrived at. Compared to my last attempt at this exercise.
Axial = 80 (8+14+7+26+25)
- Cranium N=8: occipital bone, 2 temporal bones, 2 parietal bones, sphenoid bone, ethmoid bone, frontal bone
- Face N=14: 1 vomer, 2 conchae, 2 nasal bones, 2 maxilla, 1 mandible, 2 palatine bones, 2 zygomatic bones, 2 lacrimal bones
- Extras N=7: hyoid, ears: 2 stapes, 2 malleus, 2 incus
- Vertebrae N=26, 7 cervical,12 thoracic, 5 lumbar, 1 sacrum, 1 coccyx
- Ribs+sternum N=25
- Shoulder and arms N=10: 2 each scapula, clavicle, humerus, ulna, radius
- Pelvis and legs N=10: 2 each innominate, femur, patella, femur, tibia
- Hands N=54: 16 carpals, 38 metacarpals and phalanges (thumb only 2 phalanges)
- Feet N=52: 14 tarsals, 38 metacarpals and phalanges (great toe ditto)
- fused sacrum = one bone
- fused coccyx = one bone
- fused innominates / pelvis = two bones, one left, one right
- fused mandible = one bone
- fused skull = twenty-two bones + two each of malleus incus and stapes rattling around inside the ears = six
But we really must pull each other up on is bold statements like The adult human skeleton is comprised of 206 bones when the person expressing this Certain Knowledge literally doesn't know what they're talking about because they have as much difficulty as me reconciling that number to the inventory.
Sunday, 27 October 2019
Sunday sunday 271019
- Long form essay on scientific replication, fraud and P-hacking [tnx Dau.I the Student].
- It cites Brian Nosek - multibloboprevs]
- ITCC Tree climbing competition in TN. Can you figure out what the rules might be from this clip?
- This help? It's a bit slower
- Voie Petit hand by hand
- Ueli Steck - Swiss speed climber [Full disclosure Steck died in a Himalayan fall in 2017]
- Stair running - it's a thing
- Pigs in paddocks
- Cheese on Alps
- Singing together
- Fuori dal Coro sing Adiemus by Karl Jenkins
Saturday, 26 October 2019
Thrifty Pie
- half an apple in the porridge;
- half a spud chopped into the Bolognese sauce;
- cabbage, cauliflower, broccoli stalks into the next soup.
- Never ever peel a potato
- Must stop peeling carrots for grating (I grate a lot of carrots)
Despite the insanely low price of chocolate biscuits - about the same/kg as potatoes - I make 1kg of flapjacks at the least excuse: meetings, funerals, weddings, works-dos, general consumption. They always make an acceptable gift because they are loaded with golden syrup and the oats, which make a third of the weight, fool people into thinking they are healthy. I have successfully made batches for vegans using sunflower oil instead of butter and honey instead of golden syrup, or both.
The other day The Beloved was going to spend the day with her Buddhist pals and asked for the recipe for flapjacks. I wrote butter 8 syrup 6 oats 12 flour 6 sugar 6 cinnamon shake on a scrap of paper. Supplementary question came back about whether vegan coconut oil would substitute for butter. I answered in the affirmative (what could go wrong?) and left the kitchen to chop water and haul wood in the yard. They looked golden brown great after 20 minutes but the slab had no strength and became granola before it could be cut. Turns out that TB went for bust on the coconut front and, as well as the coconut oil for butter substitute, used coconut 'flour' instead of wheat flour. There is a reason why we use wheat flour for bread, pastries, pancakes, biscuits, scones and wallpaper paste: the gluten forms long protein strings which hold the eggs, butter, currants, cherries together. Coconut flour is so much sand by comparison.
What to do with a bagful of coconut-oaty granola? Y' can't throw it out for the birds. I looked in the fridge to see how I might bring it back onto the menu. The answer lay in the prior existence of
- 300g of pastry dough
- 50g of cranberry jam
- 500ml of milk
- enough Bird's cornflour custard powder
which was just as weird as it sounds - and looks. Still I'm training myself up on the what kills not fattens school of catering and over the course of a week ate the whole thing.
Friday, 25 October 2019
Fabulous cueing again
Snooker turned out to be a surprising winner for television sport broadcasting. Back in the day on the BBC it was all criccer and rugger and soccer, with the Olympic Games throw in for variety once every four years. Now there is Sky Sports where you can find competitive bungey-jumping and lacrosse. Snooker TV wasn't going to work at all at all in black and white. When the idea was pitched to the BBC mandarins when colour telly started broadcasting, it was sniffed at because snooker involved a lot of smoking, drinking by over-weigh working class men. That was an alien class to the Cambridge educated decision makers at the Beeb. But if you think about it for a minute, it's a winner. Each match lasts about ten minutes, so you can pack as much into programme as the schedule will allow: complete games, replays, highlights, commentary can fill the [half] hour nicely. We don't have a telly at home, but visiting Pat the Salt I'd rather watch snooker than X-factor - it's better paced. It's one of the many games that I learned how to play during my very expensive education.
One of the current stars is an Australian called Neil Robertson, currently domiciled in Cambridge, UK. He looks reasonably healthy for late-30s and can crack a distant red into tight pocket better than most. In his day he has been World Champion. Not this year however because he missed his qualifying match at the beginning of October. He set off in good time for Barnsley navved by his SatNav and obeying the robot instructions headed West. Fail! Anyone who'd grown up in the UK would know that Barnsley is an old mill town in Yorkshire and from Cambridge you should start up the Great North Road A1. I don't think he made it to Barnsley, Gloucs, pop 209. But by the time he realised his mistake it was too late to turn. He was rueful rather than furious which suggests that he's a good sport.
Fabulous cueing, geography not so good. Sorry Neil!
Thursday, 24 October 2019
Lock step and language
This desire to fit in with the group is also manifest in your conversation; which rarely about substantive matter. More usually it is string of of conventional saws and clichés and echos that make us seem friendlier or at least that we are actually listening to the vapid blather of the other party. It's called phatic discourse, and is mainly used to establish empathy (or a place in the pecking order).
Turns out the blathering on with your pre-verbal child may be imperative for the kid's cognitive development. Most blokes, even doting fathers, are much more interested in getting the wean back to sleep than making goo-goo with the small, incontinent, mysterious creature in the babygro. Here's a BBC summary report, with several links to the primary literature of the science, showing that pre-verbal kids who get less focused verbal interaction with bigger people finish up with narrower language themselves. It's not enough to have the baby in the vicinity while you discuss The Match or the timing-belt of your car with the neighbour across the fence. You've got to get down with the infant and pay attention listen and react. That way the child learns that conversation is about taking turns and, later, that there are several words which mean almost the same thing. We all want our kids to use more than one descriptive adjective - especially if that adjective is fucken.
And for gawd's sake will you please leave the goddamn phone in the other room when you're having quality time with your wean? Research shows that interrupted conversations really inhibit learning new words. You may surmise that it also does bad things for self esteem: the disembodied voice emanating from Dad's black gizmo is more interesting to him than me. But beware: this is when daughters start to twist their fathers round their little fingers: 16 years later the car keys will be required.
Wednesday, 23 October 2019
De mortuis
Yesterday, when the nurse arrived at the double, she started on the SOP [standard operating procedure] for such cases including cardio pulmonary resuscitation CPR. I've done that, or at least the ventilation part of it, with no prior training, back 40+ years ago when I worked as a hospital orderly. It didn't work out in 1978, despite the best resources [well maybe untrained self excluded from 'best resources' in that case] and it happening in a hospital ward. While the Nurse tried manually to force some sort of circulation to the brain, two ambulances arrived, and the paramedics took over. I happened to leave the building at the end of the day with one of the technicians who'd been much closer to the centre than me. I said "Well at least he went quick". He replied "Not really, they went at him, CPR, defibrillator, the works, for an hour. They have to do that . . . until someone tells them to stop". An hour is a long, long time anoxic to retain any sort of quality life if they did get his heart going again. Let's ask some questions:
- Who is it who finally calls it futile and . . . tells them to stop?
- Why is that the policy?
- Is that Institute policy; paramedic policy; Nurse policy?
- Who benefits?
- Is there any sense of informed consent about these procedures from The Principal ?
Tuesday, 22 October 2019
Secondary structure
When they started to sequence The Genome Era with baker's yeast Saccharomyces cerevisiae 25+ years ago, I noticed something peculiar about the structure of chr III, the first ever eukaryotic chromosome to be sequenced. It was one of my three [3] big ideas in a life-time of science; and turned out to be probably not true. But it was nevertheless a contribution to the debate which opened up a novel way of thinking about constraints on the sequence of genes and their equivalent proteins. As more chromosomal sequences came on stream, Ken Wolfe, in the office next door, but not yet my boss, also noticed something peculiar about the order of genes. In particular he found evidence of shadowy patterns of duplicated segments. They were "shadowy" because the component genes were a) often only distantly related b) frequently missing. Thus on one chromosome you'd have 12 genes
A - B - C - D - E - J - K - P - Q - R - S - T
and elsewhere you'd find
a - b - e - f - g - h - j - l - m - n - p - q - t
What normal people saw, if they even bothered to think in gene order terms, was that a pair of neighbouring genes A,B were distantly related to another adjacent pair a,b. somewhere else in the genome. And a little further along on the same two chromosomes P,Q were sort of similar to p,q. . . . probably a coincidence, nothing to see here. What Ken saw was [hypothesis to test!] that a chunk of the genome had been duplicated, and that most of the duplicated genes had been surplus to requirements and had mutated away to pseudogene, and then to nothing-to-see-here. He was able to see the present pattern through the spectacles of evolutionary time. If you aligned the genes themselves rather than their sequences, then the signal from the pairs was boosted by the similar intervening singletons Ee Jj and Tt:
ABCDE---JK---PQRST
ab--efghj-lmnpq--t
** * * ** *
Ken bounced the idea off Denis Shields, another absurdly smart friend of mine, and they published Molecular evidence for an ancient duplication of the entire yeast genome in Nature in 1997. That paper documented the existence of 55 duplicated regions incorporating 13% of the total gene complement. That paper included Fig.2. [part shown left] which could claim a prize for the prettiest, most data-rich and informative visual display of quantitative information [Tufte] ever to come out of Ireland. It showed commendable bottle to keep digging in the gene-duplication pit when 87% of the genome was saying something else entirely.
People like me would have taken the gong from Nature and moved on to the next project. Ken kept shaking the tree, looking for, and at, these patterns in the gene order of Saccharomyces cerevisiae. Some more focused [boring, pedestrian, ordinary] scientists started shaking their heads wondering if 'poor Ken' would soon be found crouched in a corner of the senior common room muttering to himself while blocking off imaginary fragments the yeast genome with extravagant hand-gestures. Partly on the back of his Nature paper, he landed one of the first mega +mi££ion grants when SFI Science Foundation Ireland was founded at the very end of the last century. One of the first tasks he set one of the Effectives of his dream-team was to create YGOB the Yeast Gene Order Browser. I remember him trying to explain his vision to Kevin Byrne, the recently recruited Quant who was assigned this task. Kevin could spell DNA but not desoxyribonucleicacid because he was trained as a mathematical astrophysicist . . . but ygob could that boy code! The result of that collaboration was like Fig2 above but with moving parts and incorporating not one but 2 dozen species [see the paper for more details] I always thought it looked like a mighty train marshalling yard for assembling genes into their most functional order:
Like the London Tube Map, the YGOB browser distills from the noise all the relevant data into a clear graphical roadmap with all the evidence (protein sequence, gene sequence, annotation] only a click away. Bri'nt!
With this infrastructural support, Ken then got to know pretty much all the 5,500 genes that kept Saccharomyces cerevisiae ticking: who neighboured whom; which genes contributed to biochemical pathway X; which protein was the receptor for which ligand. It was an extraordinary feat of memory and deep knowledge and a lot more useful than retaining the first 5,500 digits of π. As a teacher when you know everyone in the class you know who's missing. Ken started to notice a few cases of missing data: where every species in YGOB had genes ABCDE but Candida glabrata had only ABC-E [as L]. It turned out that in a number of such cases there was a gene in the expected position but it had evolved so fast that it retained no sequence similarity to any other gene
I was started down this recent-history rabbit hole because I read a report in Chemistry World about the discovery of a 'missing gene' in Trypanosomes [prev] which are responsible for sleeping sickness one of the most scything neglected tropical diseases. Richard Rachubinski of U Alberta was looking for novel targets to kill the parasites before they could kill their human hosts and was surprisingly unable to find a homologue of PEX3 in the lists of trypanosome proteins. PEX is a family of proteins associated with the development and maintenance of peroxisomes - sub-cellular organelles which are vital for the processing of long chain fatty acids and reactive oxygen species. PEX3 remained elusive until Rachubinski went to a research presentation outside his own field and learned about a bioinformatic tool called HHPred which can infer function based on secondary structure [which is comprised of the intermediate building blocks or structural elements: α-helices; β-sheets; turns; ω-loops] even when the protein sequence is completely different from other members of a gene family. They are a long way from an effective therapeutic but the first step of identification and annotation has put them on the right path. More shadows firming up into a hard reality!
Monday, 21 October 2019
Similar proteins
are still alive. I've spent the last 30 years trying to make sense of those sequences: usually comparing them by alignment. Here's part of the sequence of insulin for pigs and humans:
SP|P01315|INS_PIG PQAGAVELGGGL--GGLQALALEGPPQKRGIVEQCCTSICSLYQLENYCN 108 SP|P01308|INS_HUMAN LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN 110
*.* ****** *.** ***** ************************
Notes:
[Each of the 20 amino acids found in proteins has a unique 1-letter code. And a more readable 3-letter code too]
{For the first half of the 20thC, diabetics were injected with insulin extracted from thousands of pig pancreases and it worked just fine.}
You can see that the sequences, and therefore by inference, their 3-D structures, are very similar but with several significant differences: the human version has two extra amino acids GA for starters. If the final functioning protein is in 3 dimensions, then the linear sequence, as it appears from the ribosomes, or as represented on paper and on screen as above, can be thought of as a 1-D object. In between, biochemists talk about the secondary structure, which is comprised of the intermediate building blocks or structural elements: α-helices; β-sheets; turns; ω-loops.
How similar do protein sequences have to be for us to believe that a) they have a common ancestor and b) they therefore have a similar structure and function? If you line up any pair of sequences, some of the letters will match because there are only 20 amino acids to play with. Like when I align the opening words of the first two paragraphs above:
Proteins are made of aminoacids
You can see that the sequences
3/30 = 10% of the letters appear in the same position in these random unrelated sequences. Molecular evolutionists talk about the twilight zone when ~15-20% of the amino acids are identical between two sequences. More than 20% identity and you can be reasonably confident is assigning similar function and inferring the same 3-dimensional structure. In the twilight zone you really need some independent information to make that call. You might naively think that the random probability is 5% = 1/20 because there are 20 amino acids to play with. But because you're allowed to insert gaps in one sequence [to accommodate the extra GA in the insulin above, for example] and because some amino acids eg LAG and more common than others eg HWC:
the biologically meaningful / statistically significant cut-off (and the Twilight Zone) are pitched higher than 5% at just under 20%. To be continued . . . as gene location becomes the added value independent information to match barely detectable similarities between genes in two different species.
Years ago, in the late 90s, I wrote some code to deconstruct protein sequences as if they had been hydrolysed by 1M NaOH [that's caustic soda to cooks] into a soup of their component amino acids. This might be though of as a protein's 0-dimensional structure. My program also tallied up and counted the frequency of each of the 20 amino acids. Tricking about with a test dataset, I noticed that this string of 20 numbers had quite high predictive value: the AA frequencies of Bacillus subtilis recA could predictably fish out the recA in Escherichia coli etc. I got sufficiently excited about this that I presented it as my contribution to the weekly internal lunchtime research seminar. Ken Wolfe, not yet my boss, but usually the smartest chap in the room, said he'd noticed this several years earlier but hadn't though it worth publishing. My abiding problem as a scientist is that I lack the stamina to get results, even interesting results, down on paper and through the publication process. I am thus glad to be able to publish this executive summary in The Journal of Blob Studies - they will take anything.
Part II.
Sunday, 20 October 2019
20ct19 Osteoporosis Day
- Lumberjacking
- Bar pinched by awkward settle
- Mighty Oak felled with a two-knob hinge
- Tree-monkeys can go home if this mother can get close to the site
- Descent:
- The Lhotse Couloir by ski . . . normalising the bat-shit bonkers.
- The Betsiamites River by Kayak
- 8000m without a parachute . . . there is a big net
- Of branches by competent tree-monkey
- Mildly amusing food anecdotes. Like Dau.I's elderflowercordial vs fish-stock mix.
- Thinking man's physics
- Mr Holland's clarinet lesson
- Arlo n Pete sing Presley
- Tao & Pete Viva la quinta /quince brigada
- The Boss Sólo le pido a Dios
- Trek: Picos de Europa
- Cabo Verde? Horácio - Cabeçada
- An everyday story of home-schooling folk in Drenthe, NL.
- Dau.I escaped from our End-of-Days Farm in September 2011, and Dau.II did a runner in May 2013. We were all so happy eating turnips and wild honey up until then.
Saturday, 19 October 2019
Dunmore Chronicles
The little cutey is my father, aged 10ish in ?1927? He is sitting on the quayside in Dunmore not looking the least bit proprietal because his father was The Gaffer. It reminds me of The Boyhood of Raleigh, without the ruffs:
And less you think that my Old Man was a passive poser for pictures, I also came across this seascape:
That was painted by my father in the Summer of 1939, just before the Scheiße trifft den Fan with WWII. The good ship D3 in the forescape is one of a class modified from a design by famous naval architect Uffa Fox and built by my grandfather, I guess with help from his son when the latter wasn't at school in Co Down or Dartmouth or sailing the main. I've always been a little in awe of my grandfather, who knew me aged 2 but not vice versa, because he died the following year in 1957. He lived a riotously adventurous life and definitely could sew on a button. On the striking coincidence front, I had just returned from England when the man who occupied my father's bed in his capacity as son of the subsequent harbourmaster of Dunmore East sent me this clipping from The Munster Express 12 Jan 1940:
Friday, 18 October 2019
Legitimate death by assault
This may remind you of The Onion's ironic take on gun-control in the USA ‘No Way To Prevent This,’ Says Only Nation Where This Regularly Happens. Which story they have published multiple times after another mass-shooting. Eddie Hearn, who makes a living matching youg men to batter each other for money, wept during his comments on Day's death "You can say 'it's boxing' but it is so hard to justify." How about saying "it's assault with a couple of deadly fists what do you expect", would that help you clarify your ethical position, Mr Hearn?
I was a child boxer. After lunch on Wednesday as eight year olds we used to flail at each other in a temporary ring set up in one of the class-rooms. But the physics of it says that small damage can be done with little fists in big padded gloves; and the past [1962] is a different country. Back then it would have been unthinkable for little girls to have a go at each other in that way; the moral corruption of society is such that Katie Taylor can now serve as a role model for young women. The case is altered when fit young adult men and women at the peak of their physical strength batter each other until one falls down . . . and someone makes money on it. Shocking is what it is. Should be unacceptable in a civilised society. And, as you know, CSE Contact Sport Encephalopathy is not limited to boxing.
We all got guts
Sources: nobody expects you, dear reader, to get down and dirty with the scientific literature. Each paper will normally present only one study indicating that bacterial strain X is associated with condition Y in either mice or humans, occasionally both. If you take the materials and methods on trust [and you shouldn't!], you can get the key factlet from the PubMed abstract. Or you can read Giulia Enders book: Gut: The Inside Story of Our Body's Most Underrated Organ; [originally Darm mit Charme. Alles über ein unterschätztes Organ] which I reviewed a tuthree weeks ago. I was all set to present an ExecSummary of that book when one of the WexSciCaf lurkers pointed me at The Psychobiotic Revolution by Anderson, Cryan and Dinan. Scott Anderson is a US-based science journalist, while John Cryan and Ted Dinan are academics from UCC in the Independent Republic of Cork.
In the airy arm-wavy world of popular science books you have to polish your crap-detector before you invest time and money in 'facts' therein presented. Here, I'll share some of the interesting intel which I gleaned from my reading.
The money is in probiotics but you and I don't want to spend our hard-earned dollars on products of dubious efficacy and doubtful quality control. Dinan & Cryan cite one study where the contents of 13 probiotic supplements were compared to what it said on the tin. Only 4/13 had a table of contents than actually matched the contents. Probiotics are food supplements and have a far lower administrative and licencing bar to leap than drugs which are classified as medicine. But the thrify should follow the prebiotics route: these are the dietary changes that can encourage the growth of good bacteria: try ginger, garlic, carrots, apples for starters. Actually, keep it simple and follow Michael Pollan [multiprev]: Eat food; not too much; mostly plants. Un-food is anything that comes in a packet with more than 6 indredients.
There has been a bit of interest recently in the few cases of auto-brewery syndrome. This occurs when a colony of bakers' yeast Saccharomyces cerevisiae, against the odds and its normal environment, sets up shop in some person's intestine. There it scarfs up any passing sugar and anaerobically converts it to ethanol and carbon dioxide. The CO2 causes a certain increase in fartiness but the alcohol crosses the intestinal epithelium and starts to intoxicate. I don't think you'd have a leg to stand on [you'd be legless, arf arf] in court if you got arrested for driving under the influence.
Now before I forget, I'll note some of the major players in the gut flora: some good and some bad; all just tryimng to make a living. There may be 1,000 different species of microbe donw in the dark, but 99% of them fit into 4 different Phyla [major groups of bacteria]
- Actinobacteria
- Bifidobacterium longum, B. breve; B. dentium [richer in infant guts]
- Proprionobacterium shermanii [bubbles in Emmenthal]
- Firmicutes
- Clostridium difficile, C. botulinum [botox]
- Bacillus cereus [re-heated rice poisoning]
- Lactobacillus spp. LABs good guys
- Bacteroidetes
- Bacteroides thetaiotaomicron [prev]; B. fragilis; B. plebeus [freq in Japan]
- Prevotella
- Proteobacteria
- alpha: Rickettsia prowazekii; Brucella abortus [prev Alice Evans]
- beta: Neisseria gonorrhoeae, [the clap] N. meningitidis [meningitis]
- gamma: Escherichia coli and other enterics incl Salmonella; Pseudomonas aerogenosa
- epsilon: Campylobacter jejuni [food poisoning] Helicobacter pylori [ulcers]
Thursday, 17 October 2019
Dirty protest
It would be hard for Davis not to take this personally as he is the sole living, broadcasting witness to the grandson's tale and is on record as believing it as fact rather than a tall tale to bamboozle the educated Westerner. It's like a colleague of mine suggesting, at the twice yearly faculty meeting, that final year student research projects involving computational molecular evolution aka bioinformatics should be marked out of 50% because they doing aren't real science . . . and then asking me not to take it as a personal attack despite me being the only person to offer and supervise such projects.
Davis responded to the critical experiment with a peculiarly pedantic essay in Nautilus (the science magazine that "combines the sciences, culture and philosophy into a single story"). As far as I gather, Davis thinks:
- there are more important things to research when the Inuit's whole world is melting under their feet
- dog butchery is significantly different from the pig butchery carried out by the Kent State team
- with a side-swipe at Western society in general and Ethical Approval Boards in particular which accepts killing pigs for food [or insulin] but gets daintily precious about treating dogs in the same way.
- shit-knives last longer and sharper when the ambient temperature is -50°C rather than whipping them out of a freezer and hacking away on the lab bench next door.
Source: Metafilter were the comments point to a Japanese experimentalist who makes knives out of ice, tin foil, rice and other unlikely products.
Did somebody mention Insulin and Banting & Best? Check out this essay about the miraculous power to cure diabetes from B&B's break-through <heart warming>.
Wednesday, 16 October 2019
Pláinéad amháin
In any society, even in Bhutan, someone rises to the top: by accident of birth; by election in representative democracy; by bloody coup; by promotion from apparatchik to chairman of the praesidium of the supreme soviet Президиум Верховного Совета. Those people are Leaders but, In Ireland at least, we no longer expect them to lead; for many years we know that our government will be craven in the face of adversity, incapable of doing anything bloody, bold or resolute in a crisis. We have a choice of two centre-right main parties which blame each other for the unpretty pass we have come to and an pathetic in thinking beyond the next election - where they will have to please everyone to win enough seats to get re-elected. Thus Paschal "Craven" Donohoe, the Finance Minister, having failed to put any increase on the carbon tax for budget 2019 last year has now put an additional €6/tonne on fuel . . . deferred till May next year for home heating oil. 6€/tonne is less than 2c/lt for unleaded and diesel. It's a token because far too many voters love their cars far too much to be offended by a painful increase in their fuel taxes. One of the points of taxation is to change behaviour to better serve the community - it's not only about raising revenue, Paschal.
On Tuesday 8th October, I was down in the next county, at the second annual plenary session of the PPN [Public Participation Network]. I don't only go to these things for the cocktail sausages afterwards; I'm also there for the cocktail party chatter and networking. One of the consequences of getting old is that I no longer hide in the t'ilets but wade in to talk to randomers to see what they do - heck, you never know how they might be interesting or useful or both. The theme of the meeting was Sustainable Communities and the PPN praesidium had arranged two separate speakers and a panel to discuss the subject. The first talk was about Bee Aware and the All Ireland Pollination Plan. It was astonishing to me that someone can have a job as liaison for this vital aspect of the future of farming [no bees; no apples, no oranges, no almonds] and be quite shameless about knowing no science. Quite apart from the fact that the All Ireland Pollination Plan is barely aspirational, let alone articulated and implemented. The second talk was about Sustainable Energy Communities. When we came back to Ireland 30 years ago The Beloved worked in fuel poverty, sustainable energy and domestic energy efficiency. Nearly 1 million homes have been built in the Republic since then, with a barely perceptible nod towards insulation or fuel efficiency: just fire up the boiler, lads! Retro-fitting is so much more expensive. At least the speaker was competent and on top of his data, even if the story was so distressingly short-sighted.
We were left with a panel discussion, the most useful part of which was a "speed-dating" session where each invited panellist was invited to name one thing that would make a difference to our planet in these "interesting" times.
- Damn single use water bottles: make them illegal, or tax them up the wazzo so that their 'convenience'becomes painful
- press windfall, part bug-eaten?, apples into juice
- make ponds for invertebrates
- damn wet-wipes: make them illegal, or tax them up the wazzo so that their 'convenience' becomes painful
- Insulate, insulate, insulate
- LED lights have a smaller footprint
- luv your daisies Bellis perennis; mow the lawn less often; feed the bees (all same thing)
- Greener cleaning products
- smokeless fuels
- take your canvas bags
You can see that some people are incapable of focussing on one big thing. cf Fox and Hedgehog. My friend and neighbour Mary White, who secured the last seat in the constituency for the Green Party in the 2007 general election, affirmed that in minority politics you can only hope to achieve one thing while in office. As a county councillor she sponsored a bye-law making recreational quad-bikes illegal on the uplands of the county. I guess she reckoned that the balance between pain and political gain among her fellow councillors would allow her that much of her green agenda. If she pitched higher she might get nothing.
Tuesday, 15 October 2019
Forensic plate pouring
I've had two weeks with these 12 students, about half of whom I had for QM [remedial math] 2 years ago. As in recent years, I'm going to appoint each pair in rotation to the rank of Autoclave Liaison Officer ALO. At least some of our students will be confident and comfortable with this potentially
Each pair of students had poured a wildly different number of plates: in general those who had poured light plates got more out them out of the bottle. That's not necessarily a good thing: the empty plates cost about €1/dozen so it's better to pour fewer plates so long as you have enough. Also thin plates dry out and blow away more readily, so don't last as long waiting to be used. Again, the shelf life needs to be enough - either one week or two weeks usually. Fat / thick plates otoh aren't getting as many functional plates from each run through the autoclave. In the table [L] I've recorded
1) the number of each type of Petri dish
2) the weight of just the plastic - count x 13.15g
3) the total weight of all the plates less the plastic
4) the average weight of each filled plate
5) the standard deviation of each batch
I've highlighted the lowest Standard Deviation [in the 3rd data column] because those boys were clearly in the zone when they were pouring - each plate the same as the last. But they still have things to learn. Expecting to pour 20 plates, they had labelled 20 empties before pouring because they poured a little mean, they only used 401g of their half litre of agar. That's enough to make 4 or 5 extra plates from the batch. But the lazy arses decided not to label the extra plates; preferring to throw away the surplus agar. If we have enough starch agar plates for the class next week, that was a good call. If not then someone will have to go sort in their investigations at the frontier of science. In the interests of nerdnik completeness here is the analysis of variance which shows clearly that there is a significant difference in the average weight of Petri dishes poured last Thursday - tsk on the quality control, lads.
Monday, 14 October 2019
Vela catches a flash of change
The current consensus is that this was an early exercise of nuclear power by Israel, probably with the collaboration or connivance of the Republic of South Apartheid RSA. President Carter's diary for Feb. 27, 1980: “We have a growing belief among our scientists that the Israelis did indeed conduct a nuclear test explosion in the ocean near the southern end of Africa.” indicates that it was the then consensus as well. But admission that Israel had become a rogue nuclear state was extremely inconvenient politically and an "independent" body of high powered US physicists, concocted a scarcely credible collision of possible natural phenomena to explain the Vela flashes. Indeed subsequent advances in science have exposed the explanation as physically impossible rather than scarcely credible.
The Vela incident thus did lasting damage to the political credibility of US policy in its fatal attraction for the state of Israel. It also did transitory damage to the scientific credibility of US technocrats who were seen to be capable to squaring any circle of deceit to suit their paymasters. It was badly done, Emma, badly done . . . badly done.
Sunday, 13 October 2019
Thirteen October
- Satie, Eric. I find his stuff super-restfulzzzzzzzzz
- Sara Bareilles et al: Once upon another time.
- First Aid Kit - un hommage to Emmylou Harris
- FAK - The Lion's Roar
- Katie Melua - Fields Of Gold
- Horse-racing wrongs bloboprev now MeFi commentary
- Lateral. A quiz for Internet "celeb" nerds led by Tom Scott.
- Primes, spirals, Dirichlet (1837). Beautiful explanation of the distribution of primes by 3blue1brown . . . just zzzzz off when it gets too much - I did.
- More narrow-gauge trains than you can shake a stick at.
Saturday, 12 October 2019
Go West young man
My academic colleagues shake their heads <tsk tsk> and wonder why none (to the nearest whole number in an average year) of our students avail of the opportunity. I don't say out loud, but I suspect it's partly because none of those <tsk tsk>ers do that sort of thing themselves and so don't really have a European network of colleagues to tap for the placement of our brightest and best. It depends on how you ask the question [ne nonne num]
"Surely you want an expenses paid trip to Spain; all the chorizo you can eat; and ready access to the films of Pedro Almodovar on the telly?"
vs
"You know that they make tea with warm water?"
I was in my one hour a week supervising lab practicals last Tuesday and one of the students, who had never been in one of my previous class groups, asked if I had any contacts in Europe or ideas about how he could position himself outside of Ireland after he graduated next May. With a quickening pulse, I asked him what field floated his boat because he hadn't signed up to do one of my computer-based projects. Turns out that he was one of two lads who had spent Summer 2019 in Dijon (where the mustard comes from) in Burgundy. So he and his pal will have completed their 12 week work placement before they sit their final exams. "My" chap had spent his time doing chemical analysis in a Kombucha lab, taking samples from the brew and measuring the phenolics, the tannins, the colour and the acidity in each batch. He'd written a long formal report for his french supervisor, albeit in English: his french is much better now than before his departure from Ireland but not yet really up to writing a report in french science-speak.
Kombucha should now be familiar to all my tree-huggin', Birkenstock-wearin', woowah-believin' readers. It is a SCOBY ferment from sweetened tea (green black white separately or together) but can also be made from fruit-juice. SCOBY? an acronym - Symbiotic Culture Of Bacteria and Yeast - where the yeast is probably not brewer/baker's Saccharomyces cerevisiae and the bacteria is some sort of Lactic Acid Bacteria LAB. There is a market for the stuff if you can make it in sufficient quantities and with reliable quality control. But as we agreed, making it is the least part of the process if you intend to retire on your money before you're 50. What makes the difference between a hobby and a fortune is branding, advertising, and distribution. I suggested that he might start building the management team for his enterprise Killeshin Kombucha by flirting with students taking the Digital Marketing course in the School of Business. I've already sown the seeds for Killeshin Soy "soy sauce with a hint of guinness", ギネスのヒント醤油 which will carry off prizes for best in class at the Tokyo Food Festival in 2029.
The two francophone biologists have been recruited by our International Office to tell their bubbly and productive story to the current cohort of 3rd Years. No better men!
Friday, 11 October 2019
No Neck
Don't get away with the idea that inbreeding is only long ago and far away. A certain amount of endogamy is expected if you live in a village without cars or buses; or in a wider community [Hutterites, Ashkenazim] where conventions limit the available partners. My Pal Johnnie, who grew up a Protestant in Tuam Co Galway, was faced with a choice of three potential opposite sex partners from his church; none of whom was less than 40 years old. When I knew him 25 years ago, he had turned sufficiently that he was dating a very nice Catholicker girl from Sligo whom he's met in Dublin.
An extensive [exec summ] and exhaustive [full paper] study of the 456,414 genomes from the UK BioBank has been carried out by a group from U. Queensland, Brisbane, AU. They analysed the status of each of 300,000 genetic variants SNPs in both copies [maternal and paternal] of these these peoples DNA. Theyfound that the genomes of 125 of them or "1 in 3,652" people born in the United Kingdom between 1938 and 1967 show extreme inbreeding, indicating couplings between full siblings, a parent and a child, a grandparent and a grandchild, all of which are specifically forbidden by the Church of England's Table of Kindred and Affinity. Most SNP variants have two possibilities from the choice of four nucleotides A T C G. If a string of SNPs in a particular part of a maternally inherited chromosome
it could have happened by chance (there are only 4 possibilities at each place after all to the odds are about 4^15 = 1bn-to-1) but, as the duplication extends, this explanation becomes increasingly unlikely. They found that this ratio of 1/3500 is about the same rate of reports to the police of incest (11,200 cases in a population if 55 million). Acknowledging that reported cases of incest are likely only a fraction of actual cases of incest (everyone knows incest is frowned upon by polite society, so the perps aren't going to bruit it abroad?) it suggests to me that motherfuckers use condoms. I never thought I'd have occasion to utter that phrase! It turns out (I'm sure you knew this already, but I live a very sheltered life) there is a brand of condom called Motherfucker Rubbers.
In a sense this is like a genetic disease and its occurrence has about the same prevalence as Duchenne Muscular Dystrophy DMD (1:3500 live births); haemophilia (1:10,000); cystic fibrosis CF (1:2,000 in Ireland, less elsewhere).
Thursday, 10 October 2019
Black dog
I think this must be the fourth case of someone making their own exit which has occurred in a 3km radius of our mountain home since we moved there 20 years ago. There is no upside to such events but I feel that repetition helps to de-stigmatise the families involved. If it happens so often, you have to be really certain in your righteousness to be judgemental. I was chatting to one of my living neighbours, who had signed up to an 8 hours shift marshalling traffic, about what a loss it must be for the family. Even a dark and broody father is still daddy. Neighbour remembered how, at the last such event in the parish, he'd been in the pub with some mates. One of them had suggested that the principle actor was 'selfish' for abandoning his wife and teenage children. A complete stranger turned round and invited him to "Shut the fuck up! You know nothing about the Black Dog. Your pal didn't know he had a family when he pitched out; all he could feel was a world of pain". The raw emotion of that unscripted response put a bit of a damper on the pints.
Last Summer a very old friend of mine from Dublin killed himself. I had to write to his wife; another old friend of mine, although they were both much younger than me. The only thing I could imagine was to say "damn those neurotransmitters" which had become so unbalanced as to teeter poor Paul off the edge. It's an imbalance like from when your immune system starts to eat your own myelin-sheath [MS] or your pancreas stops producing insulin [Type I diabetes]. But if you can scapegoat something so small, impersonal and essentially beyond our control then it may help unshoulder a portion of the blame which survivors inevitably carry with them forever. It's a bit like Niall Breslin personifying his Black Dog as Jeffrey as a way to establish some distance from the darkness. Another blobbessay on depression.
I was, as always around Irish funerals, touched and impressed by the capacity of the community to come together to navigate the transition from the ordinary daily round abruptly to the grave. And I did note the phenomenal capacity of Irish people to make and consume tea and ham sandwiches. I think we do death well in Ireland.















